PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S07187.20
Common NameJCGZ_13263, LOC105639296
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 435aa    MW: 47219.4 Da    PI: 8.3125
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S07187.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.4e-32215270156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Jcr4S07187.20 215 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 270
                    68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355212272IPR017930Myb domain
SuperFamilySSF466894.66E-17212273IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28213273IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26215270IPR006447Myb domain, plants
PfamPF002497.4E-7217268IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MIIHTSLLKR IQVFFIFFSA VETSRQQLQA YRANQGPRPL LEEFIPLKNS TSEALDKSSN  60
LSDKANWMTT AQLWSQESNI ETKPQTTLTT NSPKETSIGF NVSPKLGLDT KQRNGGAFLP  120
FSKERNLCPS PTLALASTDK EMEDKKCLES ENGFSCSKIE NSSKIGNNNS GIVIEQGKGT  180
CNSPSDGQAT NAGNGNCTNN NNNNGSSSTG QTHRKARRCW SPDLHRRFVN ALQMLGGSQV  240
ATPKQIRELM KVDGLTNDEV KSHLQKYRLH TRRPSPSPQA PGAQAPHVVF LGGIWVPPEY  300
ATAAAAAHTG APTLYGAHPA SHAPPPHFCA APPVPQDFYT AAAAAPSPPP PPHHQPHHHT  360
LHRQLHMYKA AQQTHSSPES DVRGNGERSE SIEDGKSESS SWKAESGDNA GERKGLAALR  420
EDGEESNGSE ITLKF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012078695.10.0PREDICTED: uncharacterized protein LOC105639296 isoform X1
TrEMBLA0A067KBG00.0A0A067KBG0_JATCU; Uncharacterized protein
STRINGPOPTR_0018s06410.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-44G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]